PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000210970
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 523aa    MW: 58998.2 Da    PI: 5.7984
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000210970genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.73.1e-141559348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +W++eEd++l + ++ +G+++W+ Ia+++   +t  qc+ rw++yl
    MDP0000210970 15 SWSQEEDDILRNQINTHGTENWAIIASKFK-DKTTRQCRRRWYTYL 59
                     6****************************9.*************97 PP

2Myb_DNA-binding43.57.5e-1465108146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g W++eEd ll +a k +G++ W+ Ia+ +  gRt++ +k+r+ +
    MDP0000210970  65 KGGWSPEEDMLLCEAQKIFGNR-WTEIAKVVS-GRTDNAVKNRFST 108
                      688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.14859IPR017930Myb domain
SMARTSM007172.0E-131261IPR001005SANT/Myb domain
SuperFamilySSF466891.12E-2513106IPR009057Homeodomain-like
CDDcd001675.75E-131559No hitNo description
Gene3DG3DSA:1.10.10.609.6E-211667IPR009057Homeodomain-like
PfamPF139212.7E-151676No hitNo description
PROSITE profilePS5129420.05560114IPR017930Myb domain
SMARTSM007171.1E-1464112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-1968113IPR009057Homeodomain-like
CDDcd001671.17E-1068109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MPQEESKKKE RHIVSWSQEE DDILRNQINT HGTENWAIIA SKFKDKTTRQ CRRRWYTYLN  60
SDFKKGGWSP EEDMLLCEAQ KIFGNRWTEI AKVVSGRTDN AVKNRFSTLC KKRAKYEALA  120
KENAASYINQ NDKRVKIRNG FNTDGTAETT APSKKMRRSH IPSLSEGDRL LEQCGKMSQQ  180
LRAPFAVLIQ NVHNVENLPD QNNVNGTKEV PVNAVQKSKF HGSFLKKDDP KIIALMQQAE  240
LLSSLALKVN AENTDQSLEN AWKVLQDFLN QSKDSDILSY GINDFDFQLE DLKYLLEDLR  300
STTEGSRPSW QQPDLYEESP GSSEYSTGST LLSQTEYYQV EKNEVEIGSL NQEIRPGSQS  360
IPIEGKNGVG DCEKGIFSEK QEIFPSCDEA TKDYAVVSAL SSIEFNSPIK VTPLFRSLAA  420
GIPSPKFSES ERNFLLKTLG EDSPCPNPST NPSQPPPCKR SLLQTIPAYN FTNGQLVSCH  480
PICFPSVPFF GLDFYSCTEL AISLVPECET NVSIHRQLAD IFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-271611310107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.84990.0fruit| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00259DAPTransfer from AT2G02820Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008389498.10.0PREDICTED: transcription factor MYB51 isoform X3
TrEMBLD9ZJ680.0D9ZJ68_MALDO; MYB domain class transcription factor
STRINGVIT_01s0026g01910.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34803461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14350.21e-161MYB family protein